General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q3EIR0",
        "id": "A0A3Q3EIR0_9LABR",
        "source_organism": {
            "taxId": "56723",
            "scientificName": "Labrus bergylta",
            "fullName": "Labrus bergylta (ballan wrasse)"
        },
        "name": "Mitochondrial fission factor",
        "description": [
            "Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface"
        ],
        "length": 210,
        "sequence": "MEAINKHMRVPERLSVGSGQQWRRGEEEEETTRREEHVPPAFTMQVPDRLTYTSPIRRSYSDQSFGRTPPGTPTKLKQTLARHPSSRGSGRPLLQRSSPSAHTSDPQAQHPPSSPYSLSSPQSFLQTARALGLQASQRLLQAVTQKESWSPEEDGGAAVEFIILRRQVMKMSRRLASLERHSTERRNTEVVLFSLLLSACMLNVWLWIRR",
        "proteome": "UP000261660",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9fbc87556d3541d935469df900b916583658cf25",
        "counters": {
            "domain_architectures": 1190,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1190
        }
    }
}