GET /api/protein/UniProt/A0A3Q3EIR0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q3EIR0",
"id": "A0A3Q3EIR0_9LABR",
"source_organism": {
"taxId": "56723",
"scientificName": "Labrus bergylta",
"fullName": "Labrus bergylta (ballan wrasse)"
},
"name": "Mitochondrial fission factor",
"description": [
"Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface"
],
"length": 210,
"sequence": "MEAINKHMRVPERLSVGSGQQWRRGEEEEETTRREEHVPPAFTMQVPDRLTYTSPIRRSYSDQSFGRTPPGTPTKLKQTLARHPSSRGSGRPLLQRSSPSAHTSDPQAQHPPSSPYSLSSPQSFLQTARALGLQASQRLLQAVTQKESWSPEEDGGAAVEFIILRRQVMKMSRRLASLERHSTERRNTEVVLFSLLLSACMLNVWLWIRR",
"proteome": "UP000261660",
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9fbc87556d3541d935469df900b916583658cf25",
"counters": {
"domain_architectures": 1190,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1190
}
}
}