GET /api/protein/UniProt/A0A3Q3BP35/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q3BP35",
"id": "A0A3Q3BP35_KRYMA",
"source_organism": {
"taxId": "37003",
"scientificName": "Kryptolebias marmoratus",
"fullName": "Kryptolebias marmoratus (Mangrove killifish)"
},
"name": "Parvalbumin",
"description": [
"In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions"
],
"length": 109,
"sequence": "MAFAGMLSDEDIKAAVQACQAADSFDYKAFFKTCGLAAKSADEVKKAFAIIDQDNSGFIEEDELKLFLQNFSAGARALTDKETKAFLAAGDSDGDGKIGVDEFAALVKA",
"proteome": "UP000264800",
"gene": null,
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ecca215d1474ead666e5466ef178e613f3ad8a6f",
"counters": {
"domain_architectures": 65598,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 65598
}
}
}