GET /api/protein/UniProt/A0A3Q2ZMU9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q2ZMU9",
        "id": "A0A3Q2ZMU9_KRYMA",
        "source_organism": {
            "taxId": "37003",
            "scientificName": "Kryptolebias marmoratus",
            "fullName": "Kryptolebias marmoratus (Mangrove killifish)"
        },
        "name": "BRISC and BRCA1-A complex member 2",
        "description": [
            "May play a role in homeostasis or cellular differentiation in cells of neural, epithelial and germline origins. May also act as a death receptor-associated anti-apoptotic protein, which inhibits the mitochondrial apoptotic pathway"
        ],
        "length": 366,
        "sequence": "MNNMSPEVALHRISPELRPLLCSVVRNGRVGLDSTNCLRVTDLKTGCTSLTPGPCCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPEPSELPHLVHWDAGNPECLLQLVKELIQQYHHYQCQRLHESSRLLFEYDSLLEDPSYGRNLEIYAGRKNTWTGEFSARFLLKLPVDFSNIPVYLLKDTALDPGEDVALLSVIHSSGGSSALHIPAFPSGGCLIDYVPQVCQLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLVWKDFCFLVHVDLPLYFPRDQPTLTFQSVYHFTNSGQLYSQVQTSYPYSPRWDGNEMAKRAKAYFKSFIPQFQEGAFTNGKL",
        "proteome": "UP000264800",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0070531",
                "name": "BRCA1-A complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0070552",
                "name": "BRISC complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4a4796e2c6a0043cd77b182bb1c969901e9eeea2",
        "counters": {
            "domain_architectures": 2222,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2222
        }
    }
}