GET /api/protein/UniProt/A0A3Q2X2F3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q2X2F3",
        "id": "A0A3Q2X2F3_HAPBU",
        "source_organism": {
            "taxId": "8153",
            "scientificName": "Haplochromis burtoni",
            "fullName": "Haplochromis burtoni (Burton's mouthbrooder)"
        },
        "name": "Meiotic nuclear division protein 1 homolog",
        "description": [
            "Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis"
        ],
        "length": 203,
        "sequence": "MKDFKSLEEKRTRMMEIFFDSKDVFQLKDIEKIAPKSKGIAPMTVKEVLQSLVDDNMVDCERVGTSNYYWAFPSKALHARNHKLEELQKQISEAKQRKASLEKAVEKAKVGRQDTKERSSLLKELQALREERTQLQAELEKYRECDPEVVEEMKKSNVIAKEAVSRWTDNVFAIKSWTKKKFAFDNSRIDKAFGIPEDFDYMD",
        "proteome": "UP000264840",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003690",
                "name": "double-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007131",
                "name": "reciprocal meiotic recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cc4bfb602d57e9444a84519aa131cf98a1b61337",
        "counters": {
            "domain_architectures": 2435,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2435
        }
    }
}