General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q2QC85",
        "id": "A0A3Q2QC85_FUNHE",
        "source_organism": {
            "taxId": "8078",
            "scientificName": "Fundulus heteroclitus",
            "fullName": "Fundulus heteroclitus (Killifish)"
        },
        "name": "Glycoprotein hormones alpha chain",
        "description": [
            "Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism"
        ],
        "length": 133,
        "sequence": "MSQSISHICLLALISLLLLLSPLGWSKEGQTPGCHLYPINVTIRSDRRGTCKGTHLVYACVGYCESSAFPSRYSVLVASNFTHNITSASRCCTISKDSKVKVRLDCPRGRHYDEIEILTAKACRCDMCRKSRY",
        "proteome": "UP000265000",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c41de36a481f7d27550f55756c70e925da8ec8a1",
        "counters": {
            "domain_architectures": 1246,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1246
        }
    }
}