GET /api/protein/UniProt/A0A3Q1EGD1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q1EGD1",
"id": "A0A3Q1EGD1_9TELE",
"source_organism": {
"taxId": "80966",
"scientificName": "Acanthochromis polyacanthus",
"fullName": "Acanthochromis polyacanthus (spiny chromis)"
},
"name": "Large ribosomal subunit protein eL6",
"description": [
"Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell"
],
"length": 258,
"sequence": "MAEGDKKSAKKKHGSRNPKLARGMSRYSRSAMFARRAMYKRKTKTTETKVEKKLKEKPKATVVKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPFCQHKRKLRASITPGTVLVLLTGRHRGKRVVFLKQLASGLLLVTGPLALNRVPLRRAHQKFVIATNTKVDISGMKIPKTLSDAYFKKKRLRRPRHQEGEIFDTEKEKYQLTEQRKEDQKAVDAQLLPLIKKVPQLKGYLRSSFCLSNGVYPHKLVF",
"proteome": "UP000257200",
"gene": null,
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8196665a4bc8f9da3dd6ec4c2b590f34a08ad109",
"counters": {
"domain_architectures": 3265,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3265
}
}
}