HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q1CC34",
"id": "A0A3Q1CC34_AMPOC",
"source_organism": {
"taxId": "80972",
"scientificName": "Amphiprion ocellaris",
"fullName": "Amphiprion ocellaris (Clown anemonefish)"
},
"name": "Osteoclast-stimulating factor 1",
"description": [
"Induces bone resorption, acting probably through a signaling cascade which results in the secretion of factor(s) enhancing osteoclast formation and activity"
],
"length": 846,
"sequence": "MELWRQCAMWLIDCRVLPENHRVTWEGAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREINLRPQMSQFLCLKNIRTFLGVCQERFHLKKSELFEAFDLFDVRDFAKVIDTLSTLSHSSVAVQRGFQPFPLEGCTPDDEIYSGLSDQIDDTVDEDDDLYDCVEDEENEGDEIYEDLMRTDEQPETQQKIAVDKRECCLQEIRQTEEKYTDTLDSILQHFMKPLERFLVVEEIENIFINIEDLAHTHRSMLEEVQSSILHYGAKNLYQVFLSYKERLLLYGRYCSQVEAATKHLDKLSNTREDIRMKLEECSKRANSGRFSLRDLLMVPMQRVLKYHLLLQELVKHTTDPTEKDNLRTALDAMRDLAQSVNEVKRDNEIIKQITDFQLSIVNMTQSLALYGRPKIDGELKICSSEKKSKQDRYAFLFDKAVIICKKKSGETFELKEVIELQRYQIRDETAGQKDNKKWSYLFLLLDCYGSCGYDLFFKTREMKKKWLEQFEMAISNMCPENATANNHDFQMHCFEETTSCRACSMLLRGIFFQGYRCTRCKMAAHKECLGRVPACGRNSDHSVNTKKPLQNKSRSSGHSGLGFPKMEVCQEYYGLPPPPVGFGQPLQLSKGDIIELTRANVDMNWWEGKNLTVGQMGWFPCQKVQPYISRPTPDLSAFNWFAGNMDRTAAKNLLMSRSDGTFLVRQKDGGEFAISIKFNMDIRHIKITSNEGLYRINDKKAFKGLIEMIQFYQQNSLKEYFKDVDTTLRTPYKQPEQSNSSNSTPNTTPGGSIRSFGVARARYDFSARDRSELSLREGDTIKILSKKGHSGWWKGEVYGRVGLFPANYVDEDYSDYC",
"proteome": "UP001501940",
"gene": "VAV1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005085",
"name": "guanyl-nucleotide exchange factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0035556",
"name": "intracellular signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "86144bd5c6898f9bcf3bb9dfdce523689a1c767b",
"counters": {
"domain_architectures": 188,
"entries": 56,
"isoforms": 0,
"proteomes": 1,
"sets": 9,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 6,
"cathgene3d": 6,
"ssf": 5,
"smart": 6,
"pfam": 6,
"cdd": 4,
"panther": 1,
"prosite": 2,
"prints": 3,
"interpro": 17
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 188
}
}
}