GET /api/protein/UniProt/A0A3Q0NFK5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q0NFK5",
"id": "A0A3Q0NFK5_LISMG",
"source_organism": {
"taxId": "1334565",
"scientificName": "Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness)",
"fullName": "Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness)"
},
"name": "RNA-binding protein KhpA",
"description": [
"A probable RNA chaperone. Forms a complex with KhpB which binds to cellular RNA and controls its expression. Plays a role in peptidoglycan (PG) homeostasis and cell length regulation"
],
"length": 76,
"sequence": "MEELILSIVKPLVDHPEDVVITPEETDTSLTYKLSVSKEDMGRVIGKQGRIAKAIRTLVYAVGSKNDKKIRLEIIE",
"proteome": null,
"gene": "khpA",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cc75dee3873441ef4d8b7972833f0f7bdf8e175a",
"counters": {
"domain_architectures": 11700,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ssf": 1,
"profile": 1,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 11700
}
}
}