GET /api/protein/UniProt/A0A3P9NKW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P9NKW6",
        "id": "A0A3P9NKW6_POERE",
        "source_organism": {
            "taxId": "8081",
            "scientificName": "Poecilia reticulata",
            "fullName": "Poecilia reticulata (Guppy)"
        },
        "name": "Neuromodulin",
        "description": [
            "This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction"
        ],
        "length": 237,
        "sequence": "MLCCIRRTKPVEKNEDADQKIEQDGTPNKPEDKAHKAATKIQASFRGHITRKKMKDGEEEKDGDSPAAEEAANGEETKKAEGEEAPAKQEETTGEEAKKEGEETNQAKTPGADKPANSPAGTATSPVAAAPAAASPTAATAPSEPQKEEPKAEEKPKEVEATAKSPTTATAEEKKEEKSEEKKEEARKADVPAAVSPTAEKEEPNQTNDKKDAAEESKAEENAHPDGAAETSEAKED",
        "proteome": "UP000242638",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0040008",
                "name": "regulation of growth",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e03e8336df524fecc35c19eeb84c60d1fbbc00e0",
        "counters": {
            "domain_architectures": 236,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "smart": 1,
                "profile": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 236
        }
    }
}