HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P9KBW5",
"id": "A0A3P9KBW5_ORYLA",
"source_organism": {
"taxId": "8090",
"scientificName": "Oryzias latipes",
"fullName": "Oryzias latipes (Japanese rice fish)"
},
"name": "T-cell surface glycoprotein CD3 zeta chain",
"description": [
"Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN)"
],
"length": 146,
"sequence": "MAFQTRLSGLLLLAFGLPGASAETTMLTDPRLCYILDGFLGLYGLIITGMFIKEKFFRTKVKISDEMEFSDIRPITTHHRDPEQGRQRRKQQDDRIYTGLKGQDRDEYRELPVKERPRRNEQVYQDLNAASRDTYDALQMQALPAR",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004888",
"name": "transmembrane signaling receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007166",
"name": "cell surface receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8beec6e3f5db77c0571c833c7ef099dc31c6273b",
"counters": {
"domain_architectures": 820,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 820
}
}
}