GET /api/protein/UniProt/A0A3P9DNN6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P9DNN6",
"id": "A0A3P9DNN6_9CICH",
"source_organism": {
"taxId": "106582",
"scientificName": "Maylandia zebra",
"fullName": "Maylandia zebra (zebra mbuna)"
},
"name": "Cytosolic non-specific dipeptidase",
"description": [
"Catalyzes the peptide bond hydrolysis in dipeptides, displaying a non-redundant activity toward threonyl dipeptides. Mediates threonyl dipeptide catabolism in a tissue-specific way. Has high dipeptidase activity toward cysteinylglycine, an intermediate metabolite in glutathione metabolism. Metabolizes N-lactoyl-amino acids, both through hydrolysis to form lactic acid and amino acids, as well as through their formation by reverse proteolysis. Plays a role in the regulation of cell cycle arrest and apoptosis"
],
"length": 474,
"sequence": "MAHLTELFKYVDDHQDLYVQRLAEWVGVQSVSAWPEKRGEIKKMMEMAAKDIERLGGTVELVDVGKQKLPSGEEIPLPPIILGQLGSDPAKKTVCIYGHLDVQPANISDGWDTEPFTLVEKDGKLYGRGSTDDKGPVLAWFNCIEAYQKIGKDLPINIKFCFEGMEESGSEGLDDLVFSRKDTFFKDVDYICISDNYWLGKNKPCITYGLRGICYFFLQVECAEKDLHSGVFGGSVHEAMTDLIALMGSLVDKRGKILVPGIYDSVAPLTAEEQKLYEKIDFDLDEYCKDVGVDQLLHDTKEQILMHRWRYPSLSLHGIEGAFSEAGAKTVIPRKVIGKFSIRLVPDMDPKVVEKQVIDHLQKKFAELGSPNKLKVNMGHGAKAWVSDFNHPHYMAGRKAMKTVFGVEPDLTREGGSIPVTLTFQEATGRNVMLLPVGSSDDGAHSQNEKINRSNYIQGVKLLGAYFHEVSLLE",
"proteome": "UP000265160",
"gene": null,
"go_terms": [
{
"identifier": "GO:0070573",
"name": "metallodipeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2fe7134b29da9e8c9accfe48fc79c38e73cb2340",
"counters": {
"domain_architectures": 196902,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 2,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 196902
}
}
}