GET /api/protein/UniProt/A0A3P9DNN6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P9DNN6",
        "id": "A0A3P9DNN6_9CICH",
        "source_organism": {
            "taxId": "106582",
            "scientificName": "Maylandia zebra",
            "fullName": "Maylandia zebra (zebra mbuna)"
        },
        "name": "Cytosolic non-specific dipeptidase",
        "description": [
            "Catalyzes the peptide bond hydrolysis in dipeptides, displaying a non-redundant activity toward threonyl dipeptides. Mediates threonyl dipeptide catabolism in a tissue-specific way. Has high dipeptidase activity toward cysteinylglycine, an intermediate metabolite in glutathione metabolism. Metabolizes N-lactoyl-amino acids, both through hydrolysis to form lactic acid and amino acids, as well as through their formation by reverse proteolysis. Plays a role in the regulation of cell cycle arrest and apoptosis"
        ],
        "length": 474,
        "sequence": "MAHLTELFKYVDDHQDLYVQRLAEWVGVQSVSAWPEKRGEIKKMMEMAAKDIERLGGTVELVDVGKQKLPSGEEIPLPPIILGQLGSDPAKKTVCIYGHLDVQPANISDGWDTEPFTLVEKDGKLYGRGSTDDKGPVLAWFNCIEAYQKIGKDLPINIKFCFEGMEESGSEGLDDLVFSRKDTFFKDVDYICISDNYWLGKNKPCITYGLRGICYFFLQVECAEKDLHSGVFGGSVHEAMTDLIALMGSLVDKRGKILVPGIYDSVAPLTAEEQKLYEKIDFDLDEYCKDVGVDQLLHDTKEQILMHRWRYPSLSLHGIEGAFSEAGAKTVIPRKVIGKFSIRLVPDMDPKVVEKQVIDHLQKKFAELGSPNKLKVNMGHGAKAWVSDFNHPHYMAGRKAMKTVFGVEPDLTREGGSIPVTLTFQEATGRNVMLLPVGSSDDGAHSQNEKINRSNYIQGVKLLGAYFHEVSLLE",
        "proteome": "UP000265160",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0070573",
                "name": "metallodipeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2fe7134b29da9e8c9accfe48fc79c38e73cb2340",
        "counters": {
            "domain_architectures": 196902,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 196902
        }
    }
}