HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P9CMM0",
"id": "A0A3P9CMM0_9CICH",
"source_organism": {
"taxId": "106582",
"scientificName": "Maylandia zebra",
"fullName": "Maylandia zebra (zebra mbuna)"
},
"name": "DNA-directed RNA polymerase subunit",
"description": [
"Core component of RNA polymerase I (Pol I), a DNA-dependent RNA polymerase which synthesizes ribosomal RNA precursors using the four ribonucleoside triphosphates as substrates. Can mediate Pol I proofreading of the nascent RNA transcript. Anchors into the Pol I active site to monitor transcription fidelity and cleave mis-incorporated 5'-ribonucleotides",
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 117,
"sequence": "MSCFGGGPNFCPECGNVLPLPGIPDVVCCPGCSFRIPVSEFSGQEIYSAVVFNPVEQTAVSQDEEDSEMKGAVIDRRCSRCNKEGMIYHTRQMRSADEGQTVFFTCTHCRYQEKEDS",
"proteome": "UP000265160",
"gene": null,
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2036bf1286c40e2c682b4e0987854839ceabb065",
"counters": {
"domain_architectures": 5692,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5692
}
}
}