GET /api/protein/UniProt/A0A3P9ATS5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P9ATS5",
        "id": "A0A3P9ATS5_9CICH",
        "source_organism": {
            "taxId": "106582",
            "scientificName": "Maylandia zebra",
            "fullName": "Maylandia zebra (zebra mbuna)"
        },
        "name": "Mitochondrial translation release factor in rescue",
        "description": [
            "Part of a mitoribosome-associated quality control pathway that prevents aberrant translation by responding to interruptions during elongation. As heterodimer with MTRES1, ejects the unfinished nascent chain and peptidyl transfer RNA (tRNA), respectively, from stalled ribosomes. Recruitment of mitoribosome biogenesis factors to these quality control intermediates suggests additional roles for MTRES1 and MTRF during mitoribosome rescue"
        ],
        "length": 163,
        "sequence": "VMSVFVPITSFVRMRLTWIGSLLLRPPPTGLRCVLAAGKKDLIDLPVLVEDELEEQFVRGSGPGGQATNKTSNCVVLKHIPTGIVVKCHQTRSVDINRKRAREIMREKLDVAYKGELSEVVMKKKESVLRKQEKRRKANENLERKRLLKEALAADSKPGNDTV",
        "proteome": "UP000265160",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003747",
                "name": "translation release factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006415",
                "name": "translational termination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eb9c6dcc5e90f1dbfff48cab22c80f52e0a6882c",
        "counters": {
            "domain_architectures": 24139,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24139
        }
    }
}