GET /api/protein/UniProt/A0A3P8VS92/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P8VS92",
        "id": "A0A3P8VS92_CYNSE",
        "source_organism": {
            "taxId": "244447",
            "scientificName": "Cynoglossus semilaevis",
            "fullName": "Cynoglossus semilaevis (Tongue sole)"
        },
        "name": "Protein kinase C and casein kinase substrate in neurons 3",
        "description": [
            "Plays a role in endocytosis and regulates internalization of plasma membrane proteins. Overexpression impairs internalization of SLC2A1/GLUT1 and TRPV4 and increases the levels of SLC2A1/GLUT1 and TRPV4 at the cell membrane. Inhibits the TRPV4 calcium channel activity"
        ],
        "length": 404,
        "sequence": "MSSNGDISELGSCDSFWEPGNYRRTVKRVDDGNRLCNELVSCFQERAKIEKSYALQLSDWAKRWRCIVEKGPQYGTLEKSWHAFMQAADRISELHLELRQHLAGMDSEKVRNWQKEAYHKQMMGGFKETKDADDGFRKAQKPWVRRLKEVESSKKSYHQAKKEEWTALTRETHAKADQAKSQEEVRKFTTRVERCNQESEKVRTLTHTDTHTHTHSDMEQVFDLTQEAERKRLRFFKEILLEIHTHLDLSVKEGFKDLYRDLGQTIQASNDTDDLRWWRNTHGPGMNMNWPQFEEWSPELGRSISRXXXGGHAEENVVTLTNIVSSSEDNVEFSSELSKALAVVGVPVKALYDYIGQEADELSFKAGEELLKLGSEDEQGWCKGQLSSGQVGLYPANYVHSVSS",
        "proteome": "UP000265120",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "03032927d0815d962c47e745f80865e407dc0f87",
        "counters": {
            "domain_architectures": 3464,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "ssf": 2,
                "smart": 2,
                "pfam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3464
        }
    }
}