GET /api/protein/UniProt/A0A3P8VS92/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P8VS92",
"id": "A0A3P8VS92_CYNSE",
"source_organism": {
"taxId": "244447",
"scientificName": "Cynoglossus semilaevis",
"fullName": "Cynoglossus semilaevis (Tongue sole)"
},
"name": "Protein kinase C and casein kinase substrate in neurons 3",
"description": [
"Plays a role in endocytosis and regulates internalization of plasma membrane proteins. Overexpression impairs internalization of SLC2A1/GLUT1 and TRPV4 and increases the levels of SLC2A1/GLUT1 and TRPV4 at the cell membrane. Inhibits the TRPV4 calcium channel activity"
],
"length": 404,
"sequence": "MSSNGDISELGSCDSFWEPGNYRRTVKRVDDGNRLCNELVSCFQERAKIEKSYALQLSDWAKRWRCIVEKGPQYGTLEKSWHAFMQAADRISELHLELRQHLAGMDSEKVRNWQKEAYHKQMMGGFKETKDADDGFRKAQKPWVRRLKEVESSKKSYHQAKKEEWTALTRETHAKADQAKSQEEVRKFTTRVERCNQESEKVRTLTHTDTHTHTHSDMEQVFDLTQEAERKRLRFFKEILLEIHTHLDLSVKEGFKDLYRDLGQTIQASNDTDDLRWWRNTHGPGMNMNWPQFEEWSPELGRSISRXXXGGHAEENVVTLTNIVSSSEDNVEFSSELSKALAVVGVPVKALYDYIGQEADELSFKAGEELLKLGSEDEQGWCKGQLSSGQVGLYPANYVHSVSS",
"proteome": "UP000265120",
"gene": null,
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "03032927d0815d962c47e745f80865e407dc0f87",
"counters": {
"domain_architectures": 3464,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"ssf": 2,
"smart": 2,
"pfam": 2,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3464
}
}
}