GET /api/protein/UniProt/A0A3P8V9T4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P8V9T4",
"id": "A0A3P8V9T4_CYNSE",
"source_organism": {
"taxId": "244447",
"scientificName": "Cynoglossus semilaevis",
"fullName": "Cynoglossus semilaevis (Tongue sole)"
},
"name": "Mitochondrial 2-oxodicarboxylate carrier",
"description": [
"Transports dicarboxylates across the inner membranes of mitochondria by a counter-exchange mechanism. Can transport 2-oxoadipate (2-oxohexanedioate), 2-oxoglutarate, adipate (hexanedioate), glutarate, and to a lesser extent, pimelate (heptanedioate), 2-oxopimelate (2-oxoheptanedioate), 2-aminoadipate (2-aminohexanedioate), oxaloacetate, and citrate. Plays a central role in catabolism of lysine, hydroxylysine, and tryptophan, by transporting common metabolite intermediates (such as 2-oxoadipate) into the mitochondria, where it is converted into acetyl-CoA and can enter the citric acid (TCA) cycle"
],
"length": 271,
"sequence": "MTTQSYSSWLSCLFLGLVEICLMHPLDVVKTRFQIQRGTGDPNSYKSLGDCFRTIFRNEGIFGFYKGILPPIVAETPKRAVKFFTFEQYKKLLNLTPLSPGLALSAAGLGAGLTEAVVVNPFEVVKVSLQANRDAFKEQPSSFAQARRIIKSDGFGLKGLNKGLTSTLGRHGVFNMIYFGFYFNVKDAIPTNPDPTLEFLRKFTIGLVSGTISSCVNIPFDVAKSRIQGPQPVPGEIKYRTCFQTVALVSREKGVPSFLNTGETYKTAWSM",
"proteome": "UP000265120",
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}