GET /api/protein/UniProt/A0A3P8V9T4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P8V9T4",
        "id": "A0A3P8V9T4_CYNSE",
        "source_organism": {
            "taxId": "244447",
            "scientificName": "Cynoglossus semilaevis",
            "fullName": "Cynoglossus semilaevis (Tongue sole)"
        },
        "name": "Mitochondrial 2-oxodicarboxylate carrier",
        "description": [
            "Transports dicarboxylates across the inner membranes of mitochondria by a counter-exchange mechanism. Can transport 2-oxoadipate (2-oxohexanedioate), 2-oxoglutarate, adipate (hexanedioate), glutarate, and to a lesser extent, pimelate (heptanedioate), 2-oxopimelate (2-oxoheptanedioate), 2-aminoadipate (2-aminohexanedioate), oxaloacetate, and citrate. Plays a central role in catabolism of lysine, hydroxylysine, and tryptophan, by transporting common metabolite intermediates (such as 2-oxoadipate) into the mitochondria, where it is converted into acetyl-CoA and can enter the citric acid (TCA) cycle"
        ],
        "length": 271,
        "sequence": "MTTQSYSSWLSCLFLGLVEICLMHPLDVVKTRFQIQRGTGDPNSYKSLGDCFRTIFRNEGIFGFYKGILPPIVAETPKRAVKFFTFEQYKKLLNLTPLSPGLALSAAGLGAGLTEAVVVNPFEVVKVSLQANRDAFKEQPSSFAQARRIIKSDGFGLKGLNKGLTSTLGRHGVFNMIYFGFYFNVKDAIPTNPDPTLEFLRKFTIGLVSGTISSCVNIPFDVAKSRIQGPQPVPGEIKYRTCFQTVALVSREKGVPSFLNTGETYKTAWSM",
        "proteome": "UP000265120",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}