General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P8V3C5",
        "id": "A0A3P8V3C5_CYNSE",
        "source_organism": {
            "taxId": "244447",
            "scientificName": "Cynoglossus semilaevis",
            "fullName": "Cynoglossus semilaevis (Tongue sole)"
        },
        "name": "Mitochondrial S-adenosylmethionine carrier protein",
        "description": [
            "Mitochondrial S-adenosyl-L-methionine/S-adenosyl-L-homocysteine antiporter. Mediates the exchange of cytosolic S-adenosyl-L-methionine, the predominant methyl-group donor for macromolecule methylation processes, for mitochondrial S-adenosylhomocysteine(SAH), a by-product of methylation reactions"
        ],
        "length": 331,
        "sequence": "MERRELAASLFAGGCAGMFVDLTLFPLDTIKTRLQSQQGFFKAGGFRGVYAGVPAAAVGSIPNAALFFGTYDFTKSLLGSRGPLAAPHMAPVTHMIAASLGETVACLIRVPTEVIKQRTQALPSSTSYHNLLATLQEEGVRGLYRGFGSTVLREIPFSLVQFPLWEYFKSKDPLSLFLSTPSGHIRWRRVELSWNLDLRSSSSRYSVVAEARSQTPLLAGCSVRIFCRCHSSLCYHSSRCGQDQDHARKGRLFHCKWQHPTGALRGVDNPRSYRSVRRQHIQDDLHQRWRFHLPGSLREGTTHLAIAAFRTAAHWSTGLSEAVFVSELLGH",
        "proteome": "UP000265120",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}