GET /api/protein/UniProt/A0A3P8UW97/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P8UW97",
"id": "A0A3P8UW97_CYNSE",
"source_organism": {
"taxId": "244447",
"scientificName": "Cynoglossus semilaevis",
"fullName": "Cynoglossus semilaevis (Tongue sole)"
},
"name": "Syntaxin-binding protein 6",
"description": [
"Forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis"
],
"length": 210,
"sequence": "MNAKSVINKEVFIPHDEKMLAAVQVKRRTKKKIPFLATGGQGDYMTFICLSVTNKKPFHLSITKVKQFQGLSSFVKRSQWTIDQLRQINGIDSIKDCPEFDLLFDNAFDQWVASSAGEKCTFIQILHHTCQRYCSARKPEFINCQSKLLGGNSILHSAADSVTSAVQKASQALNERGERLGRTEERTADMMNSAEQFAVTAHKLAMKHKC",
"proteome": "UP000265120",
"gene": null,
"go_terms": [
{
"identifier": "GO:0035542",
"name": "regulation of SNARE complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "374534795d7f835b8cde979145e5184aba7a88d3",
"counters": {
"domain_architectures": 1575,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"cathgene3d": 2,
"smart": 1,
"pfam": 1,
"profile": 1,
"ssf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1575
}
}
}