GET /api/protein/UniProt/A0A3P6TA39/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P6TA39",
        "id": "A0A3P6TA39_LITSI",
        "source_organism": {
            "taxId": "42156",
            "scientificName": "Litomosoides sigmodontis",
            "fullName": "Litomosoides sigmodontis (Filarial nematode worm)"
        },
        "name": "Adenylate kinase isoenzyme 1",
        "description": [
            "Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors",
            "Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP",
            "Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism"
        ],
        "length": 208,
        "sequence": "MAPIERKNIDLTPLKNANVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRAEVKSGSPRGSELNKMMENGELVPLEIVLDLIKEAMVQAVAKGSKGFLIDGYPREVKQGEQFENEIQPAKLVLFFDVSEDTLVKRCLHRAETSGRVDDNIDTIKKRLHTYITSTSPVVDYYEKQGKLVKIPSEGTVDEIFSVVQQHLDEAIGK",
        "proteome": "UP000277928",
        "gene": "NLS_LOCUS6907",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019205",
                "name": "nucleobase-containing compound kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006139",
                "name": "nucleobase-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004017",
                "name": "AMP kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004550",
                "name": "nucleoside diphosphate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009142",
                "name": "nucleoside triphosphate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046034",
                "name": "ATP metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016776",
                "name": "phosphotransferase activity, phosphate group as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006221",
                "name": "pyrimidine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a46b57a7cf67bd3398efd44d22e46eaf9e4620ea",
        "counters": {
            "domain_architectures": 27050,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 2,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27050
        }
    }
}