HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P5W7R9",
"id": "A0A3P5W7R9_9BACL",
"source_organism": {
"taxId": "2483811",
"scientificName": "Filibacter tadaridae",
"fullName": "Filibacter tadaridae"
},
"name": "Release factor glutamine methyltransferase",
"description": [
"Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif"
],
"length": 284,
"sequence": "MTEKMYESLNRASSLLTEKGLEPHTARILMEFITQKTGAAFLVDLREPLSEEQHKAFWDKTGELLEGKPVQYVIGQEYFYGHRFEVNEHVLIPRPETEELVYEAIKRSQKIFDHKAIKVADIGTGSGAIGVSFKKEWPEAIVTATDISDQSLNVAKHNAAALGAEIRFLQGDLAAPIMQEKWDVVLSNPPYIAHDEAEQMADTVLNHEPHHALFADEDGLYFYRKLAKTLPPIMNKPALIGVEIGYLQGLAVHKLFAEAFPEAVIETVKDINGKDRMIFCETCV",
"proteome": "UP000270468",
"gene": "prmC",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008276",
"name": "protein methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006479",
"name": "protein methylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032259",
"name": "methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d4221e86f6937d5af712787f4edf6ea8c5333535",
"counters": {
"domain_architectures": 20683,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20683
}
}
}