GET /api/protein/UniProt/A0A3N7G044/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3N7G044",
"id": "A0A3N7G044_POPTR",
"source_organism": {
"taxId": "3694",
"scientificName": "Populus trichocarpa",
"fullName": "Populus trichocarpa (Western balsam poplar)"
},
"name": "Vacuolar protein sorting-associated protein 26C",
"description": [
"Component of the commander complex that is essential for endosomal recycling of transmembrane cargos; the commander complex is composed of the CCC subcomplex and the retriever subcomplex. Component of the retriever complex, which is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes. In the endosomes, drives the retriever and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling"
],
"length": 344,
"sequence": "MSTKIALKFSRSNRIYRPSEPVEGKIVIKSPSSISHYGIRLSVNGSVNLQQVRGGSAGVIETFYGVVKPITIVNKSIEVKPSGKIGSGTTEVPFTMVLKQNGEKSLERFYETFHGTDVSIQYLFTVDIARGYLYKSLSATMEVIVESDKADLLERPVSPEMAIFYITQDTQRHPLLPEIKSGGFRVTGRMSTLCSLLDPISGELTVETSAVPISSIDIHLLRVESILMGEKIVTETSLIQTTQIADGDVCRNLTLPIYVILPRLLTCPSVFAGPFSIEFKVSIVISFQSELSKLHKKSDPRTPRLWVSISLNFIVEETYLFASKLSFKFQLAMETLPLELVRTR",
"proteome": "UP000006729",
"gene": "POPTR_015G037600",
"go_terms": [
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "48a17636f5b7a8739160239fa50118fb5e352930",
"counters": {
"domain_architectures": 9584,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9584
}
}
}