GET /api/protein/UniProt/A0A3N7G044/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3N7G044",
        "id": "A0A3N7G044_POPTR",
        "source_organism": {
            "taxId": "3694",
            "scientificName": "Populus trichocarpa",
            "fullName": "Populus trichocarpa (Western balsam poplar)"
        },
        "name": "Vacuolar protein sorting-associated protein 26C",
        "description": [
            "Component of the commander complex that is essential for endosomal recycling of transmembrane cargos; the commander complex is composed of the CCC subcomplex and the retriever subcomplex. Component of the retriever complex, which is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes. In the endosomes, drives the retriever and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling"
        ],
        "length": 344,
        "sequence": "MSTKIALKFSRSNRIYRPSEPVEGKIVIKSPSSISHYGIRLSVNGSVNLQQVRGGSAGVIETFYGVVKPITIVNKSIEVKPSGKIGSGTTEVPFTMVLKQNGEKSLERFYETFHGTDVSIQYLFTVDIARGYLYKSLSATMEVIVESDKADLLERPVSPEMAIFYITQDTQRHPLLPEIKSGGFRVTGRMSTLCSLLDPISGELTVETSAVPISSIDIHLLRVESILMGEKIVTETSLIQTTQIADGDVCRNLTLPIYVILPRLLTCPSVFAGPFSIEFKVSIVISFQSELSKLHKKSDPRTPRLWVSISLNFIVEETYLFASKLSFKFQLAMETLPLELVRTR",
        "proteome": "UP000006729",
        "gene": "POPTR_015G037600",
        "go_terms": [
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "48a17636f5b7a8739160239fa50118fb5e352930",
        "counters": {
            "domain_architectures": 9584,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9584
        }
    }
}