GET /api/protein/UniProt/A0A3N2D9U7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3N2D9U7",
        "id": "A0A3N2D9U7_9MICO",
        "source_organism": {
            "taxId": "120377",
            "scientificName": "Salana multivorans",
            "fullName": "Salana multivorans"
        },
        "name": "Aspartate-semialdehyde dehydrogenase",
        "description": [
            "Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate"
        ],
        "length": 362,
        "sequence": "MSEHVSDDAVAGLTVAVVGATGQVGRVVRTLLEQRDFPLARVRFFSSARSAGTTLPWKGEDVVVEDAGAASVEDLRGIDIAIFSAGGATSKAIAPLFAEAGAVVVDNSSAWRKDPDVPLVVSEVNPHALAVRPRGIIANPNCTTMAIMPVLKPLADEAGLVRLVATTYQAVSGSGVAGVEELAGQVEAALDAQAPIRGLALDGRAVGLPEPRTYVAPIAFNVVPVAGSIVDDGSAETDEEQKLRNESRKILELPDLRVAGTCVRVPVFSGHSIAVHAEFEREISPERARELLSAAPGVEVVDVPTPLGAAGNDPSYVGRIRADQSAPEGRGLVLFVSNDNLRKGAALNAVQIAELVAAELLG",
        "proteome": "UP000275356",
        "gene": "asd",
        "go_terms": [
            {
                "identifier": "GO:0016620",
                "name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008652",
                "name": "amino acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004073",
                "name": "aspartate-semialdehyde dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009088",
                "name": "L-threonine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009089",
                "name": "L-lysine biosynthetic process via diaminopimelate",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009097",
                "name": "isoleucine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006520",
                "name": "amino acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f9fead37a78f3f17b34aebdc17f03c19c953c120",
        "counters": {
            "domain_architectures": 32953,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "ssf": 2,
                "pfam": 2,
                "smart": 1,
                "cathgene3d": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32953
        }
    }
}