GET /api/protein/UniProt/A0A3M0K553/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3M0K553",
        "id": "A0A3M0K553_HIRRU",
        "source_organism": {
            "taxId": "333673",
            "scientificName": "Hirundo rustica rustica",
            "fullName": "Hirundo rustica rustica"
        },
        "name": "Serine/threonine-protein kinase Kist",
        "description": [
            "Upon serum stimulation, phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. May be involved in trafficking and/or processing of RNA"
        ],
        "length": 397,
        "sequence": "MSGCAWGAAPPLLEALGRLWEVQAPLGSGSSASVYRVRCCGDPRAPPGAVKEFVPPPGPRSGPARRPGARPPAADCAEYGFRKERAALEQLRGHRNIVTLYGVFTNHYSANGPSRCLLLELLDISVSELLLHSSNQGCSMWMIQHCARDVLEALAFLHQKGYVHADLKPRNILWSAEEECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSETECTSAVDLWSLGIVLLEMFSGMKLKHTVQSQEWKTNSSAIIDRIFASEGVVNSAIPAYHLRDLIKRNHQECECLGQWLVVASAAASAQCEEEYEDILEDIREECQKYGPVVSLLIPKENPGKGQVFVEYANAGDSKAAQKMLTGKIFDGKFVVATFYPLSAYKRGYLYQNLL",
        "proteome": "UP000269221",
        "gene": "DUI87_14564",
        "go_terms": [
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004674",
                "name": "protein serine/threonine kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6f1a3cc00b4d0d9b6fadbe7ad4f444b866860c3a",
        "counters": {
            "domain_architectures": 925,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 2,
                "profile": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 925
        }
    }
}