HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3L7H1I9",
"id": "A0A3L7H1I9_CRIGR",
"source_organism": {
"taxId": "10029",
"scientificName": "Cricetulus griseus",
"fullName": "Cricetulus griseus (Chinese hamster)"
},
"name": "Ribose-phosphate pyrophosphokinase 1",
"description": [
"Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis"
],
"length": 318,
"sequence": "MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL",
"proteome": "UP001108280",
"gene": "Prps1",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009165",
"name": "nucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004749",
"name": "ribose phosphate diphosphokinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009156",
"name": "ribonucleoside monophosphate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9641289c33c0627e0f9c614549a341e5f3b88402",
"counters": {
"domain_architectures": 39037,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"smart": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 39037
}
}
}