GET /api/protein/UniProt/A0A3L6NWM0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3L6NWM0",
"id": "A0A3L6NWM0_FUSOX",
"source_organism": {
"taxId": "396571",
"scientificName": "Fusarium oxysporum f. sp. cepae",
"fullName": "Fusarium oxysporum f. sp. cepae"
},
"name": "Stress-associated endoplasmic reticulum protein",
"description": [
"Interacts with target proteins during translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation and facilitate correct glycosylation"
],
"length": 67,
"sequence": "MAQTPQQRRRNEAFAKGNEARMGKSEDQIKKRVEKVQKSPISLFWISILGFVIFGGLVFEGISRFFG",
"proteome": null,
"gene": "BFJ65_g5994",
"go_terms": [
{
"identifier": "GO:0005783",
"name": "endoplasmic reticulum",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "11473d2f9b226fdb2f8a73509109831429b8d765",
"counters": {
"domain_architectures": 3909,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3909
}
}
}