GET /api/protein/UniProt/A0A3L6NWM0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3L6NWM0",
        "id": "A0A3L6NWM0_FUSOX",
        "source_organism": {
            "taxId": "396571",
            "scientificName": "Fusarium oxysporum f. sp. cepae",
            "fullName": "Fusarium oxysporum f. sp. cepae"
        },
        "name": "Stress-associated endoplasmic reticulum protein",
        "description": [
            "Interacts with target proteins during translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation and facilitate correct glycosylation"
        ],
        "length": 67,
        "sequence": "MAQTPQQRRRNEAFAKGNEARMGKSEDQIKKRVEKVQKSPISLFWISILGFVIFGGLVFEGISRFFG",
        "proteome": null,
        "gene": "BFJ65_g5994",
        "go_terms": [
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "11473d2f9b226fdb2f8a73509109831429b8d765",
        "counters": {
            "domain_architectures": 3909,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3909
        }
    }
}