General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3G2HJG0",
        "id": "A0A3G2HJG0_9PSED",
        "source_organism": {
            "taxId": "76759",
            "scientificName": "Pseudomonas monteilii",
            "fullName": "Pseudomonas monteilii"
        },
        "name": "Thiol:disulfide interchange protein DsbD",
        "description": [
            "Required to facilitate the formation of correct disulfide bonds in some periplasmic proteins and for the assembly of the periplasmic c-type cytochromes. Acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps"
        ],
        "length": 570,
        "sequence": "MRVFLLFLTLLLAGPLQANPFDVKPDFLPVNQAFVLTHDRQADGQMRLYFQIKPGYYLYQKRLKFDGLPADQHPQLPPALNHHDEFFGDSAVYRDQLELLLPANAQGQLRLGWQGCADAGLCYPPQTTQIDLGGSVAPVAEQAGDQALASGLQQGHLAWSLLAFFGLGLLLAFTPCSLPMLPILAGLVLGNGASARRGWLLAGVYVLSMALVYAALGVVAALLGASLQAWLQQPWLLGSLAVLFVLLALPMFGAFELQLPAALRDRLDRAGQGTRGGNLYGAALLGALSGLLLGPCMTAPLAGALLYIAQSGDVLQGALVLFSLGLGMGVPLLLLVTLGNRYLPRPGAWMERVKGVFGFVFLAMALYTLRSLLPATLLLALSGAWLIALAWASWPALQRQPALRAVPLLGALWGGLLLVGAAAGGDDLWQPLRPFAGGATPAAAQQAEDRFVTVSRPEDLQRELDAAKARGQWVMLDYYADWCVSCKVMEKQVFARSDVQAGLAGVHLLRLDVTADSPASKALLQRYQVPGPPSIIWIGPEGDERRARRITGEVDAATFQQHWAQTRSQG",
        "proteome": null,
        "gene": "dsbD",
        "go_terms": [
            {
                "identifier": "GO:0017004",
                "name": "cytochrome complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0047134",
                "name": "protein-disulfide reductase [NAD(P)H] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "16598ca63ab551fc03d8bd05c743e9f98f55fb42",
        "counters": {
            "domain_architectures": 6478,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 3,
                "profile": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6478
        }
    }
}