GET /api/protein/UniProt/A0A3D8L2A0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3D8L2A0",
        "id": "A0A3D8L2A0_9BACT",
        "source_organism": {
            "taxId": "1400979",
            "scientificName": "Pontibacter diazotrophicus",
            "fullName": "Pontibacter diazotrophicus"
        },
        "name": "Cobyrinate a,c-diamide synthase",
        "description": [
            "Catalyzes the ATP-dependent amidation of the two carboxylate groups at positions a and c of cobyrinate, using either L-glutamine or ammonia as the nitrogen source"
        ],
        "length": 432,
        "sequence": "MAKAFVIAAPWSNSGKTTFTLALCRLFKGQGLNVQPFKCGPDYIDTLHHSRAAGTPSINLDTVMMSEEHVQELFTDYTSRADVAIVEGVMGLFDGAVKGKGSSAEIAKLLDLPVILVMNASSMAYSVAPILHGLKTFDPKVKIAGVVFNFVRTESHYTFLKEACEDVGLKALGYLPPNEEIKIPSRHLGLFIEDSFEHTIDRAAKHVEAHIAVEQLLSCGKDIAVATKPRKTTLQKKYRIAVARDEVFSFTYFQNLKKFEDLGEIIWFSPLRDTTLPEADILYLAGGYPELHLEALSGNKVMKEAIAAFAAKGGKIIAECGGMMYLGKSITNEQGGTYAMTGVFDFSTSMENKKLTLGYRMVSFDKLNLSGHEFRYSSLIHHQEPPAVAQVYSASGIEVNTRLYRYKNVIASYIHFYWAEGNQLEQILDHLA",
        "proteome": "UP000256708",
        "gene": "cbiA",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042242",
                "name": "cobyrinic acid a,c-diamide synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5409390d47827e87916aea66f2621f1f3e970ecf",
        "counters": {
            "domain_architectures": 26836,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 2,
                "pfam": 2,
                "profile": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26836
        }
    }
}