GET /api/protein/UniProt/A0A3D8L2A0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3D8L2A0",
"id": "A0A3D8L2A0_9BACT",
"source_organism": {
"taxId": "1400979",
"scientificName": "Pontibacter diazotrophicus",
"fullName": "Pontibacter diazotrophicus"
},
"name": "Cobyrinate a,c-diamide synthase",
"description": [
"Catalyzes the ATP-dependent amidation of the two carboxylate groups at positions a and c of cobyrinate, using either L-glutamine or ammonia as the nitrogen source"
],
"length": 432,
"sequence": "MAKAFVIAAPWSNSGKTTFTLALCRLFKGQGLNVQPFKCGPDYIDTLHHSRAAGTPSINLDTVMMSEEHVQELFTDYTSRADVAIVEGVMGLFDGAVKGKGSSAEIAKLLDLPVILVMNASSMAYSVAPILHGLKTFDPKVKIAGVVFNFVRTESHYTFLKEACEDVGLKALGYLPPNEEIKIPSRHLGLFIEDSFEHTIDRAAKHVEAHIAVEQLLSCGKDIAVATKPRKTTLQKKYRIAVARDEVFSFTYFQNLKKFEDLGEIIWFSPLRDTTLPEADILYLAGGYPELHLEALSGNKVMKEAIAAFAAKGGKIIAECGGMMYLGKSITNEQGGTYAMTGVFDFSTSMENKKLTLGYRMVSFDKLNLSGHEFRYSSLIHHQEPPAVAQVYSASGIEVNTRLYRYKNVIASYIHFYWAEGNQLEQILDHLA",
"proteome": "UP000256708",
"gene": "cbiA",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042242",
"name": "cobyrinic acid a,c-diamide synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5409390d47827e87916aea66f2621f1f3e970ecf",
"counters": {
"domain_architectures": 26836,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 2,
"pfam": 2,
"profile": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26836
}
}
}