GET /api/protein/UniProt/A0A3B4YT04/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3B4YT04",
"id": "A0A3B4YT04_SERLL",
"source_organism": {
"taxId": "1841481",
"scientificName": "Seriola lalandi dorsalis",
"fullName": "Seriola lalandi dorsalis"
},
"name": "Vacuolar-sorting protein SNF8",
"description": [
"Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs"
],
"length": 258,
"sequence": "MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQIVQMSKQLETFKSNLEEFASKHKQEIRKNSQFRVQFQEMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLDELHQRVLKGRGKYAQDVSQDDLVRAIKKLKVMGNGFGMIPVGGSYLVQSVPAELNMDHTVVLQLAEKKGYVTVSEIKDSLKWEKERACHVLDHLLKEGLAWLDSQAAGEAQYWLPALFSELTSRDVTPEEANQMTP",
"proteome": "UP000261360",
"gene": null,
"go_terms": [
{
"identifier": "GO:0071985",
"name": "multivesicular body sorting pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000814",
"name": "ESCRT II complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fdb954cefd9f352e34528e60de206e99d1cecdba",
"counters": {
"domain_architectures": 5500,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5500
}
}
}