GET /api/protein/UniProt/A0A3B4UEU1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3B4UEU1",
"id": "A0A3B4UEU1_SERDU",
"source_organism": {
"taxId": "41447",
"scientificName": "Seriola dumerili",
"fullName": "Seriola dumerili (Greater amberjack)"
},
"name": "Ig-like domain-containing protein",
"description": [
"Cell adhesion molecule that promotes cell-cell contacts and plays important roles in the development of the nervous system. Acts by forming homophilic or heterophilic trans-dimers"
],
"length": 345,
"sequence": "MEAVQKDHWYFVVLIFLPFLKVAVQQKEAVTVRLEEGMVLDCLCPWDGNLSMVSWTKVPDKYPIAVFHPEYGVAFSHHYRRRVEFLRTTPMDGSISMMNVTHQDIGLYHCSVQTFPQGPWTRNVQVEDLGKAADRQYITEAPSPLTPEVTVADIELEAEQNSNLTIGCNHKHNGTIHQVILERMPHSQPWGIIGVCKKVEMGLVSEDYSDRGTVSCADSLDVSLHLTGVVLDDGGFYRCTFSTDVGVQTTTVLLSVAIPGTKTDITTSSADWLLLPHNHRRKKNRREEYRVKLHPSQRQVSPNLYENIPMCPRITKKSRQIRTCPVYANLQTVQSHKTRRQRHDK",
"proteome": "UP000261420",
"gene": null,
"go_terms": [
{
"identifier": "GO:0002729",
"name": "positive regulation of natural killer cell cytokine production",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5ed7c00baee6d5d5484012bbe9c8560ea78da669",
"counters": {
"domain_architectures": 138160,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 138160
}
}
}