HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3B4GNT1",
"id": "A0A3B4GNT1_9CICH",
"source_organism": {
"taxId": "303518",
"scientificName": "Pundamilia nyererei",
"fullName": "Pundamilia nyererei"
},
"name": "Delta-aminolevulinic acid dehydratase",
"description": [
"Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen"
],
"length": 331,
"sequence": "MQTPAESILHSGYFHPTLRYWQTCIADLRPDNLIYPIFVTDGADAVEPIGSLPGQARYGVNKLEGMLRPLVDNGLKCVLIFGVPAKIAKDERGSGADTDDTPAVLAVKKIRSLFPELLVACDVCLCPYTSHGHCGILNDDGALNNDASCLRLAEVALAYARAGCHIIAPSDMMDGRVRAIKQALISNGLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLAIRAVERDVREGADMLMVKPGLPYLDIMREVKDKFPTHPLAVYNVSGEFAMIWHGAQAGAFDLKAAVMEAMTAFRRAGADIIITYYTPQLLTWLKE",
"proteome": "UP000695023",
"gene": "alad",
"go_terms": [
{
"identifier": "GO:0004655",
"name": "porphobilinogen synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033014",
"name": "tetrapyrrole biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "320bf72760d0303476114b2ed248f9974d542f23",
"counters": {
"domain_architectures": 27659,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27659
}
}
}