GET /api/protein/UniProt/A0A3B4GNR2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B4GNR2",
        "id": "A0A3B4GNR2_9CICH",
        "source_organism": {
            "taxId": "303518",
            "scientificName": "Pundamilia nyererei",
            "fullName": "Pundamilia nyererei"
        },
        "name": "Trimeric intracellular cation channel type A",
        "description": [
            "Intracellular monovalent cation channel required for maintenance of rapid intracellular calcium release. Acts as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores. Opened by a change of voltage within the sarcoplasmic reticulum lumen"
        ],
        "length": 292,
        "sequence": "MDVLAVLNLGDIAQAFSKMGMFPVFDLAYYIVSILYLKYEPGSVEVSRRSPVASWLCAMLYCFGSYILADIMLGSSPVDYFQHNSHILLASAVWYLLFYCPLNLFYKCVSFLPIKLVLVALKEVVRTRKIAAGVHHAHHAYHHGFFIMVIVGYVKGSGVALMSNFEQLLRGVWRPETNEILNMSFPTKASLYGAILFTMQEAHWLPVSKSTLILIFTLFMATSKVVMTARHSHGSPFALIESWICHLLFGSPLAGGEEDHHHPPPAGAPSSPLKTKEDLSEGARKRKVKKAE",
        "proteome": "UP000695023",
        "gene": "tmem38a",
        "go_terms": [
            {
                "identifier": "GO:0005267",
                "name": "potassium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042802",
                "name": "identical protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071805",
                "name": "potassium ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e829a56002dad33062cac2ad912424016b323364",
        "counters": {
            "domain_architectures": 2815,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2815
        }
    }
}