GET /api/protein/UniProt/A0A3B4D7N0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B4D7N0",
        "id": "A0A3B4D7N0_PYGNA",
        "source_organism": {
            "taxId": "42514",
            "scientificName": "Pygocentrus nattereri",
            "fullName": "Pygocentrus nattereri (Red-bellied piranha)"
        },
        "name": "Cytochrome b-c1 complex subunit 7",
        "description": [
            "Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation"
        ],
        "length": 105,
        "sequence": "MLAGGRLLLGFRKWYYNACGFNKLGLMRDDTIYEDHDVKEAIHRLPERVYNDRMFRIKRALDLSMKQQILPKNQWTKFEEDVHYLDPYLKEVIRERKEREEWQKK",
        "proteome": "UP001501920",
        "gene": "UQCRB",
        "go_terms": [
            {
                "identifier": "GO:0006122",
                "name": "mitochondrial electron transport, ubiquinol to cytochrome c",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045275",
                "name": "respiratory chain complex III",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "22eb83434c985993e158ffc48273e26acc118027",
        "counters": {
            "domain_architectures": 5336,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5336
        }
    }
}