HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3B4CSA8",
"id": "A0A3B4CSA8_PYGNA",
"source_organism": {
"taxId": "42514",
"scientificName": "Pygocentrus nattereri",
"fullName": "Pygocentrus nattereri (Red-bellied piranha)"
},
"name": "Serine/threonine-protein kinase",
"description": [
"Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation"
],
"length": 300,
"sequence": "SGCNKLFYRKCYNSFKSRYVVGDELGQGGFGSVYKGSRISDGLQVAIKFVSKRKTSRFLYSSKAVPAEVALMQIMSQPPICNNIVQLIEWFDEPQRYILIQERPDPCMDLESFLKKQGNCMDEDMARDIMVQVVEAVNQCSKRGVLHRDIKLQNLLINIDTLEVKLIDFGCGDLIKTTPYDRYAGTFRYCPPEFLVYGSYDADPATVWSLGVLLFRMVYGHLPFASKFETIVGIFVFKDGLSKECRNLIAWCLEWLPSKRPTGEVAEPGQSGCQTTASHGRLIWLHSMRNCNYLNEVYTK",
"proteome": "UP001501920",
"gene": null,
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004674",
"name": "protein serine/threonine kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043066",
"name": "negative regulation of apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "726173b0dde7bbc50c5d845a39c992d18faf18f3",
"counters": {
"domain_architectures": 887312,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"smart": 1,
"profile": 1,
"pirsf": 1,
"panther": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 887312
}
}
}