GET /api/protein/UniProt/A0A3B3YY24/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3B3YY24",
"id": "A0A3B3YY24_9TELE",
"source_organism": {
"taxId": "48701",
"scientificName": "Poecilia mexicana",
"fullName": "Poecilia mexicana"
},
"name": "Neuron-specific calcium-binding protein hippocalcin",
"description": [
"Calcium-binding protein that may play a role in the regulation of voltage-dependent calcium channels. May also play a role in cyclic-nucleotide-mediated signaling through the regulation of adenylate and guanylate cyclases"
],
"length": 193,
"sequence": "MGKQNSKLRPEMLQDLRENTEFSDHELQEWYKGFLKDCPSGTLNVEEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDLNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSASQF",
"proteome": "UP000261480",
"gene": null,
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4403894abd2a553d27123253401701775ffd4bde",
"counters": {
"domain_architectures": 58144,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"profile": 1,
"smart": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 58144
}
}
}