General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B3UUS5",
        "id": "A0A3B3UUS5_9TELE",
        "source_organism": {
            "taxId": "48699",
            "scientificName": "Poecilia latipinna",
            "fullName": "Poecilia latipinna (sailfin molly)"
        },
        "name": "Golgi transport 1Bb",
        "description": [
            "May be involved in fusion of ER-derived transport vesicles with the Golgi complex"
        ],
        "length": 138,
        "sequence": "MISLTDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVAGLSFVIGLERTFRFFFQRHKAKATSFFLGGIFVVLTGWPIIGVVLEIYGFFLLFRGFFPVAVGFIRRVPVLGSLLSLPGIRTMVDKIGESNAMV",
        "proteome": "UP000261500",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006888",
                "name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042147",
                "name": "retrograde transport, endosome to Golgi",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cd7cfd636139ec50f795e8146efb12755b39273f",
        "counters": {
            "domain_architectures": 14819,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14819
        }
    }
}