General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B3T4W7",
        "id": "A0A3B3T4W7_9TELE",
        "source_organism": {
            "taxId": "1676925",
            "scientificName": "Paramormyrops kingsleyae",
            "fullName": "Paramormyrops kingsleyae"
        },
        "name": "Poly [ADP-ribose] polymerase",
        "description": [
            "Intracellular mono-ADP-ribosyltransferase that plays a role in different processes, such as protein translation and unfolded protein response (UPR), through the mono-ADP-ribosylation of proteins involved in those processes. Acts as an inhibitor of protein translation by catalyzing mono-ADP-ribosylation of ribosomal subunits, such as RPL14 and RPS6, thereby inhibiting polysome assembly and mRNA loading. Mono-ADP-ribosylation of ribosomal subunits is promoted by NMNAT2. Involved in the unfolded protein response (UPR) by ADP-ribosylating and activating EIF2AK3 and ERN1, two important UPR effectors. May also mediate mono-ADP-ribosylation of karyopherin KPNB1 a nuclear import factor. May not modify proteins on arginine or cysteine residues compared to other mono-ADP-ribosyltransferases"
        ],
        "length": 363,
        "sequence": "MATLQGSSARSGTSMDSSFWGLSLILHTSMSVPGMQPPLPPATVRELVRSCLHRDPVAADLRCSLFVAAALTYKRDSVLRPFPRRYASEDNKEFEALLADVSSMPGVRELVRLGPGEGEHHLALAHWVLSSRNFAVRTLQRDEYSRILELTGCEGTSMPSPDFLFELEYCNQMNAMFEKTRDGRDILYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLAVLYSPHGNGWRESLLGPLLSCIAVCEIIDHPDVKCQVKKKDSEGMDRRRARVKNSEGGEVPQKYFVVTNNQLLRVKYLLVYSQKRRSNRRPHGSSWLARHHFAITMSLYLLLLVFIGAFSSAGFQAFWHRLFRS",
        "proteome": "UP000261540",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003950",
                "name": "NAD+ poly-ADP-ribosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "941d4d4997fd02ba735c8fb6a2ebee1581888b31",
        "counters": {
            "domain_architectures": 1263,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1263
        }
    }
}