General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B3SIG9",
        "id": "A0A3B3SIG9_9TELE",
        "source_organism": {
            "taxId": "1676925",
            "scientificName": "Paramormyrops kingsleyae",
            "fullName": "Paramormyrops kingsleyae"
        },
        "name": "ATP-sensitive inward rectifier potassium channel 14",
        "description": [
            "Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages"
        ],
        "length": 473,
        "sequence": "MGAARVKRRFSVAVESPLDEEEVLHLTQSAAEMAGIGGGAGSAGTSADASPTRNGTVGRSGVNSVGGGVCLAVGGVGSTGGIPPSPDQGFAPAYPFPRGGRRRPRSRFVGKDGRCRVAFINMSERGQRYLSDLFTTCVDVRWRWMLLLFTLSFLLSWLLFGFSFWLIAFAHGDLTPPAKEQPQEEPCFQQVNGFVAAFLFSLETQTSIGYGSRSVTEACPLAVLAVVLQCIVGCIIDAFIIGAVMAKIAKPKKRNETLVFSEKAVVALRDGKLCMMWRVGNLRKSHLVEAHVRAQLLKPRVTPEGEYLPLDHVDINVGFDTGTDRIFLVSPITIVHEINEESPFFEMDKRTLESDSELEVLVILEGMVEATAMTTQCRSSYLASEILWGHRFEPVLFERKNCYEVDYSHFHCTYEIPSTPICSAKDLAEMKFIQGSRASFCYENEVALQLSSPGVQSPSPASQGESLMHAHAH",
        "proteome": "UP000261540",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005242",
                "name": "inward rectifier potassium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006813",
                "name": "potassium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e7a59055e1b20178b6e101f48a7067c5d642e21e",
        "counters": {
            "domain_architectures": 15818,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15818
        }
    }
}