GET /api/protein/UniProt/A0A3B3RYH5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B3RYH5",
        "id": "A0A3B3RYH5_9TELE",
        "source_organism": {
            "taxId": "1676925",
            "scientificName": "Paramormyrops kingsleyae",
            "fullName": "Paramormyrops kingsleyae"
        },
        "name": "Group XIIB secretory phospholipase A2-like protein",
        "description": [
            "Not known; does not seem to have catalytic activity"
        ],
        "length": 203,
        "sequence": "MPSGTCVSILFCLSLGPVAILSQEADARQAPTQMPVTPQQEPHESGWGLNAIRQSFQAVNGYFDSMVELMGGRNGVCQYRCRYGKAPLPRPDYKTPEPNGCSSSLLGFQLDVGIPAMTKCCNQLDLCYDICGSNKYRCDSKFRWCLHGICSDLKRSLGFVSKVEACETVADTLYNTVWTLGCRPYMNSQRAACYCEGEEKDEL",
        "proteome": "UP000261540",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004623",
                "name": "A2-type glycerophospholipase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016042",
                "name": "lipid catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006644",
                "name": "phospholipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050482",
                "name": "arachidonate secretion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "463b888ac613c7c364562ee13d8a2122bfec059e",
        "counters": {
            "domain_architectures": 2879,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2879
        }
    }
}