HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3B3QT99",
"id": "A0A3B3QT99_9TELE",
"source_organism": {
"taxId": "1676925",
"scientificName": "Paramormyrops kingsleyae",
"fullName": "Paramormyrops kingsleyae"
},
"name": "3-oxo-5-alpha-steroid 4-dehydrogenase",
"description": [
"Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology"
],
"length": 265,
"sequence": "MMNLLHGLLVSEAEEMRLLELMSYAMLLMAAVTFFSLLFEDVPYGRYASRKYGFPVGAKFAWFVQELPALLIPLFLLLGTSASKLDRLPNRLLLVMYFCHYLQRCLIYPFLIRGGKGTPFVSFLLAFVFCVYNGYLQGRYLSHYADYPAGWVTHPAFVSGSIMWLVGFLINLHSDHILRNLRKPGETGYKIPPGGLFEYVSGANFLGEIVEWAGFACAGCSVHSASFAVFTLVVLSSRAAAHHRWYLEKFEDYPKGRKALVPFLY",
"proteome": "UP000261540",
"gene": null,
"go_terms": [
{
"identifier": "GO:0003865",
"name": "3-oxo-5-alpha-steroid 4-dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008202",
"name": "steroid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016627",
"name": "oxidoreductase activity, acting on the CH-CH group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "249a07fa23f546641bf50c576f6f83b8fb8dadf3",
"counters": {
"domain_architectures": 12867,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12867
}
}
}