General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B3HMP7",
        "id": "A0A3B3HMP7_ORYLA",
        "source_organism": {
            "taxId": "8090",
            "scientificName": "Oryzias latipes",
            "fullName": "Oryzias latipes (Japanese rice fish)"
        },
        "name": "F-box only protein 25",
        "description": [
            "Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT)"
        ],
        "length": 356,
        "sequence": "MPFLGQDWRSPGWSWRKTEHGWKRMVYFGHELEDNNREISLKELCSDNNDHLFVGDVCELNTAKRKKDFYNNNTKFQFVFRDKWIYVQKGSTKERHGYCTLGEALNRLDFSSAIQDVRRFNYVAKLFQLIARSQLPSLSGAAQKNYFNILEKIVRKVLEDHYNPRLVKELLQDLNSTLHSLTLHVGRCVLVGNVNIWLCRLETIVKWQQELNDLEIPKQIYSGMSFSDLPLHMHNKILCNLSDAFDIINLGQATPTLQVLSENGTLWKKLCLFHFSDKLFCRNLVINKNDNVDWKLMYYSLLKHYPMKEQYGDTLHFCKHCSILFWKDFGHPCTASDPDSCLMPVSPQHFIDLFMF",
        "proteome": "UP000001038",
        "gene": "FBXO25",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ddc68126a7624dc1c83b5aa3a62b25d11d821648",
        "counters": {
            "domain_architectures": 1704,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1704
        }
    }
}