GET /api/protein/UniProt/A0A3B1IGN6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B1IGN6",
        "id": "A0A3B1IGN6_ASTMX",
        "source_organism": {
            "taxId": "7994",
            "scientificName": "Astyanax mexicanus",
            "fullName": "Astyanax mexicanus (Blind cave fish)"
        },
        "name": "GDP-fucose protein O-fucosyltransferase 2",
        "description": [
            "Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in the consensus sequence C1-X-X-S/T-C2 of thrombospondin type I repeats (TSRs) where C1 and C2 are the first and second cysteines of the repeat, respectively. O-fucosylates members of several protein families including the ADAMTS, the thrombospondin (TSP) and spondin families. Required for the proper secretion of ADAMTS family members such as ADAMTSL1 and ADAMTS13. The O-fucosylation of TSRs is also required for restricting epithelial to mesenchymal transition (EMT), maintaining the correct patterning of mesoderm and localization of the definite endoderm"
        ],
        "length": 449,
        "sequence": "MRVLRVMADVRGSGLCGLCYYYYGIVLLCFYSALFSCTLSSEQDAFRAGNPTGAPVAAAARDIRYLLYDVNPPEGFNLRRDVYIRMASLVKTLRKQGDWVLVLPPWGRLYHWKSSDVHQLRIPWAEFFSLNSLQANVPVIEYEEFIAESGGPFIDQVLVLQNYAEGWTEGKWEEKVDERPCIERLMYTKDKQGYYRGWFWGYEETRALNVSCISAQGHASILAPFLQENITAISVLLDRAETVLHDHYAGKDYWDTRRSMVFAKHLRMIGDQFRAKYLNSTDEQDHTPYSEDWTRMKAKLGSAKGGPYLGVHLRRSDFIWGHRDDVPSLKGAVKKIRSLMKKNKLDKVFIATDADEEEVAKLRKRLPEMIRYEPSPEDLELLKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREIMGFDPKTTYNRFCGDLEKECEQPTHWKIVY",
        "proteome": "UP000018467",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0046922",
                "name": "peptide-O-fucosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036066",
                "name": "protein O-linked glycosylation via fucose",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ed7b567cc863f572716fedf1cc7b81fac229d2a1",
        "counters": {
            "domain_architectures": 28158,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28158
        }
    }
}