General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A395GXM2",
        "id": "A0A395GXM2_9EURO",
        "source_organism": {
            "taxId": "1448316",
            "scientificName": "Aspergillus ibericus CBS 121593",
            "fullName": "Aspergillus ibericus CBS 121593"
        },
        "name": "Glucanase",
        "description": [
            "The biological conversion of cellulose to glucose generally requires three types of hydrolytic enzymes: (1) Endoglucanases which cut internal beta-1,4-glucosidic bonds; (2) Exocellobiohydrolases that cut the disaccharide cellobiose from the non-reducing end of the cellulose polymer chain; (3) Beta-1,4-glucosidases which hydrolyze the cellobiose and other short cello-oligosaccharides to glucose"
        ],
        "length": 406,
        "sequence": "MRTFSTLSLSLSPFLLSGVRAIPAASATAATSVAAAASSSPAPTATATGNPFEGYQLYVNPYYKSEVESQAIPSLTGSLVAQASAVAEVPSFYWLDTADKVPIMGEYLEDIQTQNAAGANPPIAGIFVVYDLPDRDCAALASNGEYSISDGGVEKYKAYIDSIREQIETYSDVQTILIIEPDSLANLVTNLNVAKCANAESAYLECTNYALEQLNLANVAMYLDAGHAGWLGWPANIGPAAQLFASVYANASSPAAVRGLATNVANYNAWSIDSCPSYTSGNDVCDEQSYINAIAPELTSAGFDAHFITDTGRNGKQPTGQNAWGDWCNVKGTGFGARPSTDTGNELADAFVWVKPGGESDGTSDSSAERYDAHCGYSDALQPAPEAGTWFQAFFEQLLTNANPSL",
        "proteome": "UP000249402",
        "gene": "BO80DRAFT_357029",
        "go_terms": [
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030245",
                "name": "cellulose catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba730be6f9dc875c4331b2102703a1e36ee27d4d",
        "counters": {
            "domain_architectures": 5782,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5782
        }
    }
}