General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A386HCW3",
        "id": "A0A386HCW3_9GAMM",
        "source_organism": {
            "taxId": "1604335",
            "scientificName": "Yersinia rochesterensis",
            "fullName": "Yersinia rochesterensis"
        },
        "name": "Multidrug efflux pump accessory protein AcrZ",
        "description": [
            "AcrA-AcrB-AcrZ-TolC is a drug efflux protein complex with a broad substrate specificity. This protein binds to AcrB and is required for efflux of some but not all substrates, suggesting it may influence the specificity of drug export"
        ],
        "length": 46,
        "sequence": "MLDLLKSLLFAVVMVPVVMAVILGLIYGLGEVFNIISKSSNKKERA",
        "proteome": "UP000031883",
        "gene": "acrZ",
        "go_terms": [
            {
                "identifier": "GO:0042910",
                "name": "xenobiotic transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1990961",
                "name": "xenobiotic detoxification by transmembrane export across the plasma membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "46f01995ef39f03cd049838a2b3bae837a264779",
        "counters": {
            "domain_architectures": 1050,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1050
        }
    }
}