General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A384CNR9",
        "id": "A0A384CNR9_URSMA",
        "source_organism": {
            "taxId": "29073",
            "scientificName": "Ursus maritimus",
            "fullName": "Ursus maritimus (Polar bear)"
        },
        "name": "Phosphatidate cytidylyltransferase, mitochondrial",
        "description": [
            "Catalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), an essential intermediate in the synthesis of phosphatidylglycerol, cardiolipin and phosphatidylinositol"
        ],
        "length": 306,
        "sequence": "MALQALQSSGVAFRKILSHFPEELSLAFAYGSGVYRQVGPSSDQKNAMLDFVFTVDDPVAWHSQNLKKNWSHYSFLKVLGPKIITTIQNNYGAGVYYNPLITCDGRVKIIAMNENVALRSALDKNLKSAVTTAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGNILQENPQVVYKIQQGRLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGEVVRLGLSAIVRPSSMKQSTKGIFTAGVKKSVVYSSLKLHKMWKGWLRKAS",
        "proteome": "UP000261680",
        "gene": "TAMM41",
        "go_terms": [
            {
                "identifier": "GO:0004605",
                "name": "phosphatidate cytidylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0032049",
                "name": "cardiolipin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5d002a2370c90569e8539fd135f7572ff9f389b1",
        "counters": {
            "domain_architectures": 293,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 293
        }
    }
}