GET /api/protein/UniProt/A0A384CN67/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A384CN67",
"id": "A0A384CN67_URSMA",
"source_organism": {
"taxId": "29073",
"scientificName": "Ursus maritimus",
"fullName": "Ursus maritimus (Polar bear)"
},
"name": "Ubiquitin-conjugating enzyme E2 C",
"description": [
"Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit"
],
"length": 140,
"sequence": "MTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYVQETYSKQLSSQDP",
"proteome": "UP000261680",
"gene": "UBE2C",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "96b2a7d582dea26386e8f982d2fd40014d2b06f9",
"counters": {
"domain_architectures": 122920,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"smart": 1,
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 122920
}
}
}