HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A380MIC8",
"id": "A0A380MIC8_9GAMM",
"source_organism": {
"taxId": "13276",
"scientificName": "Suttonella indologenes",
"fullName": "Suttonella indologenes"
},
"name": "Coproporphyrinogen-III oxidase",
"description": [
"Involved in the heme biosynthesis. Catalyzes the anaerobic oxidative decarboxylation of propionate groups of rings A and B of coproporphyrinogen III to yield the vinyl groups in protoporphyrinogen IX"
],
"length": 457,
"sequence": "MTAYFDAALIEKYRMSGPRYTSYPTAVQFTDQFTQEDHIRHLQASNAGKRDLSVYLHIPFCEHVCYFCGCNKIITRNHSKSGEYLDYLTQDITRQAAHIDSDRRMIQLHYGGGTPTFISMDEQSRLMDLLHRHFRFADDHEGEFSIEIDPRTINRDYLAHLRKLGFNRVSFGVQDFDPAVQKAVNRIQPREEVARLMEDARDLGFHSISVDLIYGLPLQTVDSFSHTLEQMIELAPDRLAIFNYAHMPDLFGAQKQIKQADLPSPAVKLAILERTIAMLTGADYEFIGLDHFAKPEDSLVKHQKNGTLYRNFQGYSTFSDTDLLGFGISAISQVQGSYSQNHKARDKYYRAIDGGDLAIARGVALNSDDEIRRYVITEIMCNLGLDLAKVSAKYGIDAVAYFAKEWAQLEPLAADGLLQLQGNRMQVQAPGRLLIRNIAMVFDAYLQAEKHRFSQVI",
"proteome": "UP000254575",
"gene": "hemN_1",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004109",
"name": "coproporphyrinogen oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006779",
"name": "porphyrin-containing compound biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3f14abdb6574b7269bf481c8d51855c1b58a68b7",
"counters": {
"domain_architectures": 29085,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"smart": 1,
"pfam": 2,
"cathgene3d": 2,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"sfld": 3,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29085
}
}
}