GET /api/protein/UniProt/A0A380L6K1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A380L6K1",
        "id": "A0A380L6K1_9STRE",
        "source_organism": {
            "taxId": "33040",
            "scientificName": "Streptococcus milleri",
            "fullName": "Streptococcus milleri"
        },
        "name": "Inosine-5'-monophosphate dehydrogenase",
        "description": [
            "Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth"
        ],
        "length": 493,
        "sequence": "MSNWDTKFLKKGFTFDDVLLIPAESHVLPNDANLQTKLAENLTLNIPIITAAMDTVTESKMAIAIARAGGLGVIHKNMSIEQQADEIRKVKRSENGVIIDPFFLTPTHTVSDAEELMERYRISGVPVVETLENRKLVGIITNRDMRFITDYNQPISAHMTSKNLVTAPVGTDLETAERILHEHRIEKLPLVDDYGRLSGLITIKDIEKVIEFPNAAKDEYGRLLVAGAVGVTSDTFERAEALFEAGADAIVIDTAHGHSAGVLRKIAEIREHFPERTLIAGNIATAEGARALYDAGVDVVKVGIGPGSICTTRVIAGVGVPQVTAIYDAAQVAREYGKTIIADGGIQYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIFQGRKFKTYRGMGSIAAMKKGSSDRYFQGSVNEANKLVPEGIEGRVAYKGAAADIVFQMIGGVRSGMGYCGAANLQELHDKAQFIEMSGAGLKESHPHDVQITNEAPNYSVQ",
        "proteome": "UP000255236",
        "gene": "guaB",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003938",
                "name": "IMP dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006164",
                "name": "purine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9a01abf0d371224a404878e839c2974d8a828f12",
        "counters": {
            "domain_architectures": 30944,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "smart": 2,
                "cdd": 2,
                "pfam": 2,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30944
        }
    }
}