GET /api/protein/UniProt/A0A377Z215/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A377Z215",
"id": "A0A377Z215_KLEPN",
"source_organism": {
"taxId": "72407",
"scientificName": "Klebsiella pneumoniae subsp. pneumoniae",
"fullName": "Klebsiella pneumoniae subsp. pneumoniae"
},
"name": "Ribosomal RNA small subunit methyltransferase J",
"description": [
"Specifically methylates the guanosine in position 1516 of 16S rRNA"
],
"length": 250,
"sequence": "MKICLIDETGAGDGALSVLAARWGLEQDDDNPMALALTTEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADGLLAPARQLATKRVVVKRPDYAPPLADVATPNAVVTKGHRFDIYAGTPA",
"proteome": null,
"gene": "rsmJ",
"go_terms": [
{
"identifier": "GO:0008990",
"name": "rRNA (guanine-N2-)-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0031167",
"name": "rRNA methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "888efb95bd03fdc3ce9b01f53a170042ccd67559",
"counters": {
"domain_architectures": 7345,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7345
}
}
}