GET /api/protein/UniProt/A0A377HQS6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A377HQS6",
        "id": "A0A377HQS6_GRIHO",
        "source_organism": {
            "taxId": "673",
            "scientificName": "Grimontia hollisae",
            "fullName": "Grimontia hollisae"
        },
        "name": "Type II secretion system protein I",
        "description": [
            "Component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm"
        ],
        "length": 120,
        "sequence": "MRTHRGFTLIEVLVAMAVFAVAAMAVLNATGQHVNSLGALEEKTFASMVADNELALFVLDGKKLSSAKNGSSELAGRTWFWTLKPVATADNLLRAVDMIVWKNETRQHSLVTVRTYVPAE",
        "proteome": null,
        "gene": "NCTC11645_02887",
        "go_terms": [
            {
                "identifier": "GO:0015628",
                "name": "protein secretion by the type II secretion system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015627",
                "name": "type II protein secretion system complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5fb6e4e66bf5a3e4cfda5aeca3f4e668bd4b5a86",
        "counters": {
            "domain_architectures": 4428,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ncbifam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4428
        }
    }
}