GET /api/protein/UniProt/A0A368XSR2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A368XSR2",
"id": "A0A368XSR2_MARNT",
"source_organism": {
"taxId": "2743",
"scientificName": "Marinobacter nauticus",
"fullName": "Marinobacter nauticus (Marinobacter hydrocarbonoclasticus)"
},
"name": "DNA gyrase inhibitor YacG",
"description": [
"Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase"
],
"length": 62,
"sequence": "MNVECPTCKKSVEWSEANPWRPFCSERCKLIDLGAWANEEYRVPAENASPDDLDQGGEVTRH",
"proteome": "UP000253065",
"gene": "yacG",
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ef27551cf764ab45c001792b439a9233c230771f",
"counters": {
"domain_architectures": 8017,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8017
}
}
}