GET /api/protein/UniProt/A0A346NNU3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A346NNU3",
        "id": "A0A346NNU3_9ALTE",
        "source_organism": {
            "taxId": "2303538",
            "scientificName": "Salinimonas sediminis",
            "fullName": "Salinimonas sediminis"
        },
        "name": "Pyridoxine/pyridoxamine 5'-phosphate oxidase",
        "description": [
            "Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP)"
        ],
        "length": 212,
        "sequence": "MAISDMRRQYAMGTLEEASLTAHPITLFSRWLDEAIAAGIPDPTAMTVASVDATGQPSQRIVLLKDVGEQGFVFYTNLGSRKARELSSNPKVSLHFPWFFMERQVRICGTASKLSLKQNAEYFFSRPKDSQLAAFASRQSQPISSRQLLLTQFAQLKQKFADRTLPVPDFWGGFLVAPHQIEFWQGGEDRLHDRFEYNKDAQGNWSTQRLMP",
        "proteome": "UP000262073",
        "gene": "pdxH",
        "go_terms": [
            {
                "identifier": "GO:0004733",
                "name": "pyridoxamine phosphate oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008615",
                "name": "pyridoxine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016638",
                "name": "oxidoreductase activity, acting on the CH-NH2 group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b1ec9dec797efe48ef99d7dd910cd2ef548f8153",
        "counters": {
            "domain_architectures": 21075,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21075
        }
    }
}